PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G3769
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 341aa    MW: 37545.9 Da    PI: 5.8893
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G3769genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.22.3e-10153202554
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                  kr++r + NR +A+rs ++K  ++ eLe+kv++L++e ++L   l   + 
  Gh_A05G3769 153 KRAKRIIANRRSATRSKEKKALYMSELERKVQTLQTEATTLSAHLTLFQR 202
                  9****************************************988876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.0E-14149213IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.002151214IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.2E-10153207No hitNo description
SuperFamilySSF579591.29E-9153204No hitNo description
PfamPF001701.0E-8153200IPR004827Basic-leucine zipper domain
CDDcd147031.09E-21154203No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MQDPRNLNPN PDPAFPSFTQ NMPSFSNPIQ YRGSYHRRAQ SEVQFRIPDD LDLVSDSFEG  60
VGSEDDMFCS YMDIEMPGES AKGVEVAAGS WSQNRKGEEV SGGSGIGEKY NGGGKGRHRY  120
SNSVDGCSIM ESIEAKKAMA PDKLAELWTI DPKRAKRIIA NRRSATRSKE KKALYMSELE  180
RKVQTLQTEA TTLSAHLTLF QRDTTGLTTE NAELKLRLQA MEQQAQLCDA LNEALKKEVE  240
RLKTATGEIT TPTDTFNLGM HHISYAQSSF FPPQNTQLPP FHPFHSNLLT SASNTNSHAL  300
ADMMQQDPLG LLQGLDTSSR GSPFVKSESP SICAAESSGT V
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.97450.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012460397.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P47e-96RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0B0N4B90.0A0A0B0N4B9_G
STRINGVIT_13s0067g02900.t011e-132(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.14e-96bZIP family protein